Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 344382..345184 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | M5D98_RS01610 | Protein ID | WP_224687828.1 |
| Coordinates | 344657..345184 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | X6CQ11 |
| Locus tag | M5D98_RS01605 | Protein ID | WP_023765563.1 |
| Coordinates | 344382..344660 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS01580 (M5D98_01580) | 339939..340823 | - | 885 | WP_224687824.1 | DMT family transporter | - |
| M5D98_RS01585 (M5D98_01585) | 341021..341428 | - | 408 | WP_224687825.1 | DUF2000 family protein | - |
| M5D98_RS01590 (M5D98_01590) | 341476..342351 | + | 876 | WP_224687826.1 | AraC family transcriptional regulator | - |
| M5D98_RS01595 (M5D98_01595) | 342368..342838 | - | 471 | WP_013891578.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| M5D98_RS01600 (M5D98_01600) | 343255..344322 | + | 1068 | WP_224687827.1 | GTP-binding protein | - |
| M5D98_RS01605 (M5D98_01605) | 344382..344660 | + | 279 | WP_023765563.1 | DUF1778 domain-containing protein | Antitoxin |
| M5D98_RS01610 (M5D98_01610) | 344657..345184 | + | 528 | WP_224687828.1 | GNAT family N-acetyltransferase | Toxin |
| M5D98_RS01615 (M5D98_01615) | 345245..346219 | + | 975 | WP_224687829.1 | WD40 repeat domain-containing protein | - |
| M5D98_RS01620 (M5D98_01620) | 346235..346687 | - | 453 | WP_224687830.1 | hypothetical protein | - |
| M5D98_RS01625 (M5D98_01625) | 346846..348228 | + | 1383 | WP_224687831.1 | aspartate aminotransferase family protein | - |
| M5D98_RS01630 (M5D98_01630) | 348240..349640 | + | 1401 | WP_224687832.1 | glutamine synthetase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 18804.45 Da Isoelectric Point: 8.3004
>T245035 WP_224687828.1 NZ_CP097252:344657-345184 [Mesorhizobium opportunistum]
VTLPSWHEEAIAKRHNRNSFDCGDTHMNDFLRRFARQSHEQNAAKTFCAVDDAAPERILGFYTIAPSAVAHENVPAAMTK
GLARHEVSGFKLARLATDLTAAGNGLGGQLLAAAALRCLRLAGEGGGILLIIDAKSERAAKWYASYGVERLQGSDLTLAM
PLATFATDLRTKGLL
VTLPSWHEEAIAKRHNRNSFDCGDTHMNDFLRRFARQSHEQNAAKTFCAVDDAAPERILGFYTIAPSAVAHENVPAAMTK
GLARHEVSGFKLARLATDLTAAGNGLGGQLLAAAALRCLRLAGEGGGILLIIDAKSERAAKWYASYGVERLQGSDLTLAM
PLATFATDLRTKGLL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|