Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1678445..1679057 | Replicon | chromosome |
| Accession | NZ_CP097251 | ||
| Organism | Streptococcus pyogenes strain 21SPY7071 isolate cerebral abscess | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q1JJZ2 |
| Locus tag | M3N36_RS08540 | Protein ID | WP_002988077.1 |
| Coordinates | 1678722..1679057 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | M3N36_RS08535 | Protein ID | WP_002988079.1 |
| Coordinates | 1678445..1678732 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N36_RS08510 (M3N36_08510) | 1673637..1674620 | - | 984 | WP_011184964.1 | tagatose-bisphosphate aldolase | - |
| M3N36_RS08515 (M3N36_08515) | 1674624..1675553 | - | 930 | WP_030127320.1 | tagatose-6-phosphate kinase | - |
| M3N36_RS08520 (M3N36_08520) | 1675599..1676114 | - | 516 | WP_030127321.1 | galactose-6-phosphate isomerase subunit LacB | - |
| M3N36_RS08525 (M3N36_08525) | 1676149..1676577 | - | 429 | WP_011529004.1 | galactose-6-phosphate isomerase subunit LacA | - |
| M3N36_RS08530 (M3N36_08530) | 1677022..1677795 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| M3N36_RS08535 (M3N36_08535) | 1678445..1678732 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| M3N36_RS08540 (M3N36_08540) | 1678722..1679057 | + | 336 | WP_002988077.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M3N36_RS08545 (M3N36_08545) | 1679155..1680190 | + | 1036 | Protein_1644 | site-specific integrase | - |
| M3N36_RS08550 (M3N36_08550) | 1680322..1680714 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| M3N36_RS08555 (M3N36_08555) | 1680735..1681181 | - | 447 | WP_011018228.1 | 50S ribosomal protein L13 | - |
| M3N36_RS08560 (M3N36_08560) | 1681399..1681605 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| M3N36_RS08565 (M3N36_08565) | 1681602..1682300 | - | 699 | WP_030127323.1 | hypothetical protein | - |
| M3N36_RS08570 (M3N36_08570) | 1682436..1683296 | - | 861 | WP_030127324.1 | DegV family protein | - |
| M3N36_RS08575 (M3N36_08575) | 1683393..1683911 | - | 519 | WP_011889154.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13117.83 Da Isoelectric Point: 5.2144
>T245034 WP_002988077.1 NZ_CP097251:1678722-1679057 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVAIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A660A236 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |