Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1561049..1561565 | Replicon | chromosome |
| Accession | NZ_CP097248 | ||
| Organism | Klebsiella pneumoniae strain NTU107224 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | M5D84_RS07565 | Protein ID | WP_009309309.1 |
| Coordinates | 1561049..1561333 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M5D84_RS07570 | Protein ID | WP_002886901.1 |
| Coordinates | 1561323..1561565 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D84_RS07540 (1556533) | 1556533..1556841 | - | 309 | WP_002886907.1 | PTS sugar transporter subunit IIB | - |
| M5D84_RS07545 (1556926) | 1556926..1557099 | + | 174 | Protein_1474 | hypothetical protein | - |
| M5D84_RS07550 (1557102) | 1557102..1557845 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M5D84_RS07555 (1558202) | 1558202..1560340 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M5D84_RS07560 (1560581) | 1560581..1561045 | + | 465 | WP_032418146.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M5D84_RS07565 (1561049) | 1561049..1561333 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5D84_RS07570 (1561323) | 1561323..1561565 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M5D84_RS07575 (1561643) | 1561643..1563553 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M5D84_RS07580 (1563576) | 1563576..1564730 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M5D84_RS07585 (1564797) | 1564797..1565537 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T245023 WP_009309309.1 NZ_CP097248:c1561333-1561049 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |