Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 848553..849172 Replicon chromosome
Accession NZ_CP097248
Organism Klebsiella pneumoniae strain NTU107224

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M5D84_RS04160 Protein ID WP_002892050.1
Coordinates 848954..849172 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M5D84_RS04155 Protein ID WP_002892066.1
Coordinates 848553..848927 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5D84_RS04145 (843705) 843705..844898 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M5D84_RS04150 (844921) 844921..848067 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit AcrB -
M5D84_RS04155 (848553) 848553..848927 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M5D84_RS04160 (848954) 848954..849172 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M5D84_RS04165 (849331) 849331..849897 + 567 WP_087842734.1 maltose O-acetyltransferase -
M5D84_RS04170 (849869) 849869..850009 - 141 WP_004147370.1 hypothetical protein -
M5D84_RS04175 (850030) 850030..850500 + 471 WP_002892026.1 YlaC family protein -
M5D84_RS04180 (850475) 850475..851926 - 1452 WP_038989586.1 PLP-dependent aminotransferase family protein -
M5D84_RS04185 (852027) 852027..852725 + 699 WP_032434109.1 GNAT family protein -
M5D84_RS04190 (852722) 852722..852862 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M5D84_RS04195 (852862) 852862..853125 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245021 WP_002892050.1 NZ_CP097248:848954-849172 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245021 WP_002892066.1 NZ_CP097248:848553-848927 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References