Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3545039..3545670 | Replicon | chromosome |
Accession | NZ_CP097245 | ||
Organism | Leptospira santarosai strain DCP-017 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5D10_RS16025 | Protein ID | WP_269025760.1 |
Coordinates | 3545269..3545670 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M5D10_RS16020 | Protein ID | WP_075918871.1 |
Coordinates | 3545039..3545272 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5D10_RS15995 (M5D10_15965) | 3541689..3542336 | - | 648 | WP_004460452.1 | biosynthetic peptidoglycan transglycosylase | - |
M5D10_RS16000 (M5D10_15970) | 3542339..3543001 | - | 663 | WP_032919653.1 | RibD family protein | - |
M5D10_RS16005 (M5D10_15975) | 3542998..3543225 | - | 228 | WP_004476676.1 | (2Fe-2S)-binding protein | - |
M5D10_RS16010 (M5D10_15980) | 3543321..3544721 | + | 1401 | WP_052754255.1 | MFS transporter | - |
M5D10_RS16015 (M5D10_15985) | 3544819..3545028 | + | 210 | WP_002629717.1 | hypothetical protein | - |
M5D10_RS16020 (M5D10_15990) | 3545039..3545272 | + | 234 | WP_075918871.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M5D10_RS16025 (M5D10_15995) | 3545269..3545670 | + | 402 | WP_269025760.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5D10_RS16030 (M5D10_16000) | 3545925..3546160 | + | 236 | Protein_3165 | IS5/IS1182 family transposase | - |
M5D10_RS16035 (M5D10_16005) | 3546195..3546989 | - | 795 | WP_269025761.1 | hypothetical protein | - |
M5D10_RS16040 (M5D10_16010) | 3547034..3548290 | + | 1257 | WP_269025763.1 | hypothetical protein | - |
M5D10_RS16045 (M5D10_16015) | 3548384..3548968 | + | 585 | WP_004460438.1 | cytochrome C oxidase subunit IV family protein | - |
M5D10_RS16050 (M5D10_16020) | 3549155..3549799 | + | 645 | WP_004460436.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15569.32 Da Isoelectric Point: 9.5697
>T245019 WP_269025760.1 NZ_CP097245:3545269-3545670 [Leptospira santarosai]
MTHYLLDTNICIYIINQKPESVYKKFKKIKLENIFISSITEFELKYDVQKSLHFERNLKVLEEFLGYLNILQFVSKDASK
AAKIRVELERVGKPIGPFDLLIASQALANKLTLVTNNEKEFARIKEIKMESWL
MTHYLLDTNICIYIINQKPESVYKKFKKIKLENIFISSITEFELKYDVQKSLHFERNLKVLEEFLGYLNILQFVSKDASK
AAKIRVELERVGKPIGPFDLLIASQALANKLTLVTNNEKEFARIKEIKMESWL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|