Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2865069..2865697 | Replicon | chromosome |
| Accession | NZ_CP097245 | ||
| Organism | Leptospira santarosai strain DCP-017 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | K8Y570 |
| Locus tag | M5D10_RS13035 | Protein ID | WP_004463182.1 |
| Coordinates | 2865069..2865467 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M6ZBJ3 |
| Locus tag | M5D10_RS13040 | Protein ID | WP_004468228.1 |
| Coordinates | 2865467..2865697 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D10_RS13005 (M5D10_12980) | 2860244..2860633 | - | 390 | WP_004480843.1 | helix-turn-helix transcriptional regulator | - |
| M5D10_RS13010 (M5D10_12985) | 2860958..2862079 | + | 1122 | WP_269025368.1 | helix-turn-helix domain-containing protein | - |
| M5D10_RS13015 (M5D10_12990) | 2862082..2862258 | - | 177 | WP_269025369.1 | hypothetical protein | - |
| M5D10_RS13020 (M5D10_12995) | 2862319..2863752 | + | 1434 | WP_269026461.1 | DDE-type integrase/transposase/recombinase | - |
| M5D10_RS13025 (M5D10_13000) | 2864097..2864378 | + | 282 | WP_032927939.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M5D10_RS13030 (M5D10_13005) | 2864394..2864690 | + | 297 | WP_016757297.1 | HigA family addiction module antitoxin | - |
| M5D10_RS13035 (M5D10_13010) | 2865069..2865467 | - | 399 | WP_004463182.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5D10_RS13040 (M5D10_13015) | 2865467..2865697 | - | 231 | WP_004468228.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M5D10_RS13045 (M5D10_13020) | 2865924..2866136 | - | 213 | WP_269025370.1 | hypothetical protein | - |
| M5D10_RS13050 (M5D10_13025) | 2866185..2866358 | - | 174 | WP_004468364.1 | hypothetical protein | - |
| M5D10_RS13055 (M5D10_13030) | 2866403..2869147 | - | 2745 | WP_269025371.1 | isoleucine--tRNA ligase | - |
| M5D10_RS13060 (M5D10_13035) | 2869155..2869808 | - | 654 | WP_004468285.1 | leucine-rich repeat domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14980.51 Da Isoelectric Point: 9.4739
>T245018 WP_004463182.1 NZ_CP097245:c2865467-2865069 [Leptospira santarosai]
MYLLDTNICIFLIKKKSQKLLDKLKKNFNKGLYISSLTLAELEFGIENSEQKEKNRVSLIEFLSIFEILPFEQSDAQAFG
ILKADLKKSGNPIGSIDALLAAQALSRVLVLITNNTKEFKRVKNLSIEDWSQ
MYLLDTNICIFLIKKKSQKLLDKLKKNFNKGLYISSLTLAELEFGIENSEQKEKNRVSLIEFLSIFEILPFEQSDAQAFG
ILKADLKKSGNPIGSIDALLAAQALSRVLVLITNNTKEFKRVKNLSIEDWSQ
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2R4L8Y5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M6ZBJ3 |