Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpIK/PemK(toxin) |
| Location | 2692866..2693442 | Replicon | chromosome |
| Accession | NZ_CP097245 | ||
| Organism | Leptospira santarosai strain DCP-017 | ||
Toxin (Protein)
| Gene name | chpK | Uniprot ID | - |
| Locus tag | M5D10_RS12265 | Protein ID | WP_269025250.1 |
| Coordinates | 2692866..2693207 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | chpI | Uniprot ID | M6JN71 |
| Locus tag | M5D10_RS12270 | Protein ID | WP_004462036.1 |
| Coordinates | 2693194..2693442 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D10_RS12250 (M5D10_12225) | 2688380..2688769 | - | 390 | WP_002762646.1 | response regulator | - |
| M5D10_RS12255 (M5D10_12230) | 2688889..2690598 | - | 1710 | WP_004462031.1 | EAL domain-containing protein | - |
| M5D10_RS12260 (M5D10_12235) | 2690791..2692401 | + | 1611 | WP_004474711.1 | adenylate/guanylate cyclase domain-containing protein | - |
| M5D10_RS12265 (M5D10_12240) | 2692866..2693207 | - | 342 | WP_269025250.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M5D10_RS12270 (M5D10_12245) | 2693194..2693442 | - | 249 | WP_004462036.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| M5D10_RS12275 (M5D10_12250) | 2693945..2694169 | - | 225 | WP_004466072.1 | hypothetical protein | - |
| M5D10_RS12280 (M5D10_12255) | 2694166..2694348 | - | 183 | WP_026131333.1 | hypothetical protein | - |
| M5D10_RS12285 (M5D10_12260) | 2694551..2695654 | + | 1104 | WP_004474734.1 | histidinol-phosphate transaminase | - |
| M5D10_RS12290 (M5D10_12265) | 2695921..2696061 | + | 141 | WP_004462050.1 | hypothetical protein | - |
| M5D10_RS12295 (M5D10_12270) | 2696062..2697333 | - | 1272 | WP_004474793.1 | replication-associated recombination protein A | - |
| M5D10_RS12300 (M5D10_12275) | 2697334..2697558 | - | 225 | WP_004470113.1 | hypothetical protein | - |
| M5D10_RS12305 (M5D10_12280) | 2697738..2698358 | - | 621 | WP_004462057.1 | VTT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | acpXL | 2387053..2830044 | 442991 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12395.20 Da Isoelectric Point: 6.3473
>T245017 WP_269025250.1 NZ_CP097245:c2693207-2692866 [Leptospira santarosai]
MTRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNRSNINTIVSIAVTSNLNLSEAPGNVLITKKDSNLSKDSVVDVSQIV
TLDKERFLNKAGKLKTNKLNEVGEGLRLVAGLE
MTRGEIWWVDLGIPFGSEPGFKRPVLIIQDDSFNRSNINTIVSIAVTSNLNLSEAPGNVLITKKDSNLSKDSVVDVSQIV
TLDKERFLNKAGKLKTNKLNEVGEGLRLVAGLE
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|