Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 1098980..1099545 | Replicon | chromosome |
| Accession | NZ_CP097245 | ||
| Organism | Leptospira santarosai strain DCP-017 | ||
Toxin (Protein)
| Gene name | mazE | Uniprot ID | K8YH10 |
| Locus tag | M5D10_RS04870 | Protein ID | WP_004458030.1 |
| Coordinates | 1098980..1099303 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M5D10_RS04875 | Protein ID | WP_026053376.1 |
| Coordinates | 1099303..1099545 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D10_RS04855 (M5D10_04845) | 1094817..1095512 | - | 696 | WP_004464119.1 | ABC transporter ATP-binding protein | - |
| M5D10_RS04860 (M5D10_04850) | 1095925..1097049 | - | 1125 | WP_004458035.1 | SpoIID/LytB domain-containing protein | - |
| M5D10_RS04865 (M5D10_04855) | 1097221..1098576 | - | 1356 | WP_269026144.1 | DNA adenine methylase | - |
| M5D10_RS04870 (M5D10_04860) | 1098980..1099303 | - | 324 | WP_004458030.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M5D10_RS04875 (M5D10_04865) | 1099303..1099545 | - | 243 | WP_026053376.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M5D10_RS04880 (M5D10_04870) | 1099980..1101071 | - | 1092 | WP_269026146.1 | DUF1565 domain-containing protein | - |
| M5D10_RS04885 (M5D10_04875) | 1101683..1102663 | - | 981 | WP_269026147.1 | transporter | - |
| M5D10_RS04890 (M5D10_04880) | 1102663..1103541 | - | 879 | WP_269026148.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12250.67 Da Isoelectric Point: 10.3519
>T245015 WP_004458030.1 NZ_CP097245:c1099303-1098980 [Leptospira santarosai]
MVIAQYEVYLINLDPTIGYEIKKSRPCVIISPNEMNKTIGTIIIAPMTTKSRTYPTRIELTFQGKKGWIVLDQIRTVDKV
RLIKKLGKIDSKISNQLKSIIKEMLVD
MVIAQYEVYLINLDPTIGYEIKKSRPCVIISPNEMNKTIGTIIIAPMTTKSRTYPTRIELTFQGKKGWIVLDQIRTVDKV
RLIKKLGKIDSKISNQLKSIIKEMLVD
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|