Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 12503..13146 | Replicon | 1 plasmid p70.8 |
Accession | NZ_CP097240 | ||
Organism | Klebsiella pneumoniae strain |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | M4268_RS27855 | Protein ID | WP_001044770.1 |
Coordinates | 12730..13146 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | M4268_RS27850 | Protein ID | WP_001261282.1 |
Coordinates | 12503..12733 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4268_RS27815 (M4268_27825) | 8075..8941 | - | 867 | WP_004118283.1 | replication initiation protein | - |
M4268_RS27820 (M4268_27830) | 9476..9580 | + | 105 | WP_032409716.1 | hypothetical protein | - |
M4268_RS27825 (M4268_27835) | 9709..9966 | + | 258 | WP_000764642.1 | hypothetical protein | - |
M4268_RS27830 (M4268_27840) | 10024..10800 | - | 777 | WP_000015958.1 | site-specific integrase | - |
M4268_RS27835 (M4268_27845) | 10797..11540 | - | 744 | WP_000129823.1 | hypothetical protein | - |
M4268_RS27840 (M4268_27850) | 11591..11941 | - | 351 | WP_000493378.1 | hypothetical protein | - |
M4268_RS27845 (M4268_27855) | 12085..12546 | - | 462 | WP_072202616.1 | hypothetical protein | - |
M4268_RS27850 (M4268_27860) | 12503..12733 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M4268_RS27855 (M4268_27865) | 12730..13146 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4268_RS27860 (M4268_27870) | 13220..13909 | + | 690 | Protein_16 | AAA family ATPase | - |
M4268_RS27865 (M4268_27875) | 13964..14661 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
M4268_RS27870 (M4268_27880) | 14746..15606 | - | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
M4268_RS27875 (M4268_27885) | 15789..16106 | - | 318 | Protein_19 | recombinase family protein | - |
M4268_RS27880 (M4268_27890) | 16306..17130 | - | 825 | WP_000722315.1 | oxacillin-hydrolyzing class D beta-lactamase OXA-9 | - |
M4268_RS27885 (M4268_27895) | 17190..17978 | - | 789 | WP_001206315.1 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..70829 | 70829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T245013 WP_001044770.1 NZ_CP097240:12730-13146 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |