Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 163052..163803 | Replicon | 1 plasmid p283.4 |
| Accession | NZ_CP097238 | ||
| Organism | Klebsiella pneumoniae strain | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | M4268_RS26630 | Protein ID | WP_014386536.1 |
| Coordinates | 163321..163803 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | M4268_RS26625 | Protein ID | WP_004902250.1 |
| Coordinates | 163052..163330 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4268_RS26590 (M4268_26600) | 158695..159120 | - | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
| M4268_RS26595 (M4268_26605) | 159148..159423 | - | 276 | WP_043907009.1 | mercury resistance system periplasmic binding protein MerP | - |
| M4268_RS26600 (M4268_26610) | 159439..159804 | - | 366 | WP_004200999.1 | mercuric ion transporter MerT | - |
| M4268_RS26605 (M4268_26615) | 159876..160331 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| M4268_RS26610 (M4268_26620) | 160984..161442 | + | 459 | WP_014386535.1 | hypothetical protein | - |
| M4268_RS26615 (M4268_26625) | 162272..162613 | + | 342 | WP_004902257.1 | hypothetical protein | - |
| M4268_RS26620 (M4268_26630) | 162721..162933 | + | 213 | WP_004902255.1 | hypothetical protein | - |
| M4268_RS26625 (M4268_26635) | 163052..163330 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| M4268_RS26630 (M4268_26640) | 163321..163803 | + | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| M4268_RS26635 (M4268_26645) | 164838..165377 | + | 540 | WP_004902239.1 | hypothetical protein | - |
| M4268_RS26640 (M4268_26650) | 165482..165874 | + | 393 | WP_032442757.1 | hypothetical protein | - |
| M4268_RS26645 (M4268_26655) | 165975..166730 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| M4268_RS26650 (M4268_26660) | 166757..167404 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA14 / blaOXA-1 / aac(6')-Ib-cr / qnrB1 / blaNDM-1 / aph(3')-VI / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..283371 | 283371 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T245012 WP_014386536.1 NZ_CP097238:163321-163803 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |