Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3024314..3024933 Replicon chromosome
Accession NZ_CP097237
Organism Klebsiella pneumoniae strain

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4268_RS14480 Protein ID WP_002892050.1
Coordinates 3024314..3024532 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4268_RS14485 Protein ID WP_002892066.1
Coordinates 3024559..3024933 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4268_RS14445 (3020361) 3020361..3020624 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
M4268_RS14450 (3020624) 3020624..3020764 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4268_RS14455 (3020761) 3020761..3021459 - 699 WP_004178762.1 GNAT family protein -
M4268_RS14460 (3021560) 3021560..3023011 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4268_RS14465 (3022986) 3022986..3023456 - 471 WP_002892026.1 YlaC family protein -
M4268_RS14470 (3023477) 3023477..3023617 + 141 WP_004147370.1 hypothetical protein -
M4268_RS14475 (3023589) 3023589..3024155 - 567 WP_002892030.1 maltose O-acetyltransferase -
M4268_RS14480 (3024314) 3024314..3024532 - 219 WP_002892050.1 HHA domain-containing protein Toxin
M4268_RS14485 (3024559) 3024559..3024933 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4268_RS14490 (3025419) 3025419..3028565 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4268_RS14495 (3028588) 3028588..3029781 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245004 WP_002892050.1 NZ_CP097237:c3024532-3024314 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245004 WP_002892066.1 NZ_CP097237:c3024933-3024559 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References