Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2319273..2319789 | Replicon | chromosome |
| Accession | NZ_CP097237 | ||
| Organism | Klebsiella pneumoniae strain | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M4268_RS11205 | Protein ID | WP_004178374.1 |
| Coordinates | 2319505..2319789 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M4268_RS11200 | Protein ID | WP_002886901.1 |
| Coordinates | 2319273..2319515 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4268_RS11185 (2315301) | 2315301..2316041 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| M4268_RS11190 (2316108) | 2316108..2317262 | + | 1155 | WP_004178372.1 | lactonase family protein | - |
| M4268_RS11195 (2317285) | 2317285..2319195 | + | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
| M4268_RS11200 (2319273) | 2319273..2319515 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M4268_RS11205 (2319505) | 2319505..2319789 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4268_RS11210 (2319793) | 2319793..2320257 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M4268_RS11215 (2320498) | 2320498..2322636 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M4268_RS11220 (2322993) | 2322993..2323736 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M4268_RS11225 (2323739) | 2323739..2323912 | - | 174 | WP_032408826.1 | hypothetical protein | - |
| M4268_RS11230 (2324042) | 2324042..2324305 | + | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T245002 WP_004178374.1 NZ_CP097237:2319505-2319789 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |