Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 1850710..1851335 | Replicon | chromosome |
Accession | NZ_CP097237 | ||
Organism | Klebsiella pneumoniae strain |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | M4268_RS08975 | Protein ID | WP_002882817.1 |
Coordinates | 1850952..1851335 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | M4268_RS08970 | Protein ID | WP_004150355.1 |
Coordinates | 1850710..1850952 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4268_RS08945 (1846701) | 1846701..1847300 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
M4268_RS08950 (1847294) | 1847294..1848154 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
M4268_RS08955 (1848151) | 1848151..1848588 | + | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
M4268_RS08960 (1848633) | 1848633..1849574 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
M4268_RS08965 (1849588) | 1849588..1850505 | - | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
M4268_RS08970 (1850710) | 1850710..1850952 | + | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
M4268_RS08975 (1850952) | 1850952..1851335 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4268_RS08980 (1851509) | 1851509..1852438 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
M4268_RS08985 (1852435) | 1852435..1853070 | - | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
M4268_RS08990 (1853067) | 1853067..1853969 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T245000 WP_002882817.1 NZ_CP097237:1850952-1851335 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |