Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 944513..945170 | Replicon | chromosome |
Accession | NZ_CP097237 | ||
Organism | Klebsiella pneumoniae strain |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M4268_RS04550 | Protein ID | WP_004181233.1 |
Coordinates | 944513..944923 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M4268_RS04555 | Protein ID | WP_002916312.1 |
Coordinates | 944904..945170 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4268_RS04530 (940513) | 940513..942246 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M4268_RS04535 (942252) | 942252..942965 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M4268_RS04540 (942988) | 942988..943884 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M4268_RS04545 (943985) | 943985..944506 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
M4268_RS04550 (944513) | 944513..944923 | - | 411 | WP_004181233.1 | protein YgfX | Toxin |
M4268_RS04555 (944904) | 944904..945170 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M4268_RS04560 (945416) | 945416..946399 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M4268_RS04565 (946550) | 946550..947209 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
M4268_RS04570 (947373) | 947373..947684 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M4268_RS04575 (947734) | 947734..948462 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M4268_RS04580 (948581) | 948581..950014 | + | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T244998 WP_004181233.1 NZ_CP097237:c944923-944513 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|