Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 12503..13146 Replicon plasmid p70.8
Accession NZ_CP097235
Organism Klebsiella pneumoniae strain 4

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M4269_RS27920 Protein ID WP_001044770.1
Coordinates 12730..13146 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M4269_RS27915 Protein ID WP_001261282.1
Coordinates 12503..12733 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4269_RS27880 (M4269_27880) 8075..8941 - 867 WP_004118283.1 replication initiation protein -
M4269_RS27885 (M4269_27885) 9476..9580 + 105 WP_032409716.1 hypothetical protein -
M4269_RS27890 (M4269_27890) 9709..9966 + 258 WP_000764642.1 hypothetical protein -
M4269_RS27895 (M4269_27895) 10024..10800 - 777 WP_000015958.1 site-specific integrase -
M4269_RS27900 (M4269_27900) 10797..11540 - 744 WP_000129823.1 hypothetical protein -
M4269_RS27905 (M4269_27905) 11591..11941 - 351 WP_000493378.1 hypothetical protein -
M4269_RS27910 (M4269_27910) 12085..12546 - 462 WP_072202616.1 hypothetical protein -
M4269_RS27915 (M4269_27915) 12503..12733 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4269_RS27920 (M4269_27920) 12730..13146 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M4269_RS27925 (M4269_27925) 13220..13909 + 690 Protein_16 AAA family ATPase -
M4269_RS27930 (M4269_27930) 13964..14661 + 698 WP_223174630.1 IS1 family transposase -
M4269_RS27935 (M4269_27935) 14746..15606 - 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M4269_RS27940 (M4269_27940) 15789..16106 - 318 Protein_19 recombinase family protein -
M4269_RS27945 (M4269_27945) 16306..17130 - 825 WP_000722315.1 oxacillin-hydrolyzing class D beta-lactamase OXA-9 -
M4269_RS27950 (M4269_27950) 17190..17978 - 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 - 1..70829 70829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T244997 WP_001044770.1 NZ_CP097235:12730-13146 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT244997 WP_001261282.1 NZ_CP097235:12503-12733 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References