Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4191764..4192421 | Replicon | chromosome |
| Accession | NZ_CP097232 | ||
| Organism | Klebsiella pneumoniae strain 4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M4269_RS20245 | Protein ID | WP_004181233.1 |
| Coordinates | 4192011..4192421 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M4269_RS20240 | Protein ID | WP_002916312.1 |
| Coordinates | 4191764..4192030 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4269_RS20215 (4186920) | 4186920..4188353 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
| M4269_RS20220 (4188472) | 4188472..4189200 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| M4269_RS20225 (4189250) | 4189250..4189561 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| M4269_RS20230 (4189725) | 4189725..4190384 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| M4269_RS20235 (4190535) | 4190535..4191518 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| M4269_RS20240 (4191764) | 4191764..4192030 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M4269_RS20245 (4192011) | 4192011..4192421 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
| M4269_RS20250 (4192428) | 4192428..4192949 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| M4269_RS20255 (4193050) | 4193050..4193946 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M4269_RS20260 (4193969) | 4193969..4194682 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M4269_RS20265 (4194688) | 4194688..4196421 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T244994 WP_004181233.1 NZ_CP097232:4192011-4192421 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|