Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2817145..2817661 | Replicon | chromosome |
Accession | NZ_CP097232 | ||
Organism | Klebsiella pneumoniae strain 4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M4269_RS13590 | Protein ID | WP_004178374.1 |
Coordinates | 2817145..2817429 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M4269_RS13595 | Protein ID | WP_002886901.1 |
Coordinates | 2817419..2817661 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4269_RS13565 (2812629) | 2812629..2812892 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
M4269_RS13570 (2813022) | 2813022..2813195 | + | 174 | WP_032408826.1 | hypothetical protein | - |
M4269_RS13575 (2813198) | 2813198..2813941 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M4269_RS13580 (2814298) | 2814298..2816436 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M4269_RS13585 (2816677) | 2816677..2817141 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M4269_RS13590 (2817145) | 2817145..2817429 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4269_RS13595 (2817419) | 2817419..2817661 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M4269_RS13600 (2817739) | 2817739..2819649 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
M4269_RS13605 (2819672) | 2819672..2820826 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M4269_RS13610 (2820893) | 2820893..2821633 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T244990 WP_004178374.1 NZ_CP097232:c2817429-2817145 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |