Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2112002..2112621 Replicon chromosome
Accession NZ_CP097232
Organism Klebsiella pneumoniae strain 4

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4269_RS10315 Protein ID WP_002892050.1
Coordinates 2112403..2112621 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4269_RS10310 Protein ID WP_002892066.1
Coordinates 2112002..2112376 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4269_RS10300 (2107154) 2107154..2108347 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4269_RS10305 (2108370) 2108370..2111516 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4269_RS10310 (2112002) 2112002..2112376 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4269_RS10315 (2112403) 2112403..2112621 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4269_RS10320 (2112780) 2112780..2113346 + 567 WP_002892030.1 maltose O-acetyltransferase -
M4269_RS10325 (2113318) 2113318..2113458 - 141 WP_004147370.1 hypothetical protein -
M4269_RS10330 (2113479) 2113479..2113949 + 471 WP_002892026.1 YlaC family protein -
M4269_RS10335 (2113924) 2113924..2115375 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4269_RS10340 (2115476) 2115476..2116174 + 699 WP_004178762.1 GNAT family protein -
M4269_RS10345 (2116171) 2116171..2116311 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4269_RS10350 (2116311) 2116311..2116574 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244988 WP_002892050.1 NZ_CP097232:2112403-2112621 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244988 WP_002892066.1 NZ_CP097232:2112002-2112376 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References