Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2112002..2112621 | Replicon | chromosome |
Accession | NZ_CP097232 | ||
Organism | Klebsiella pneumoniae strain 4 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M4269_RS10315 | Protein ID | WP_002892050.1 |
Coordinates | 2112403..2112621 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M4269_RS10310 | Protein ID | WP_002892066.1 |
Coordinates | 2112002..2112376 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4269_RS10300 (2107154) | 2107154..2108347 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M4269_RS10305 (2108370) | 2108370..2111516 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M4269_RS10310 (2112002) | 2112002..2112376 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M4269_RS10315 (2112403) | 2112403..2112621 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M4269_RS10320 (2112780) | 2112780..2113346 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M4269_RS10325 (2113318) | 2113318..2113458 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M4269_RS10330 (2113479) | 2113479..2113949 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M4269_RS10335 (2113924) | 2113924..2115375 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
M4269_RS10340 (2115476) | 2115476..2116174 | + | 699 | WP_004178762.1 | GNAT family protein | - |
M4269_RS10345 (2116171) | 2116171..2116311 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M4269_RS10350 (2116311) | 2116311..2116574 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244988 WP_002892050.1 NZ_CP097232:2112403-2112621 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244988 WP_002892066.1 NZ_CP097232:2112002-2112376 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |