Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 30116..30759 | Replicon | plasmid p70.8 |
Accession | NZ_CP097230 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | M4270_RS28045 | Protein ID | WP_001044770.1 |
Coordinates | 30343..30759 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | M4270_RS28040 | Protein ID | WP_001261282.1 |
Coordinates | 30116..30346 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS28005 (M4270_27995) | 25688..26554 | - | 867 | WP_004118283.1 | replication initiation protein | - |
M4270_RS28010 (M4270_28000) | 27089..27193 | + | 105 | WP_032409716.1 | hypothetical protein | - |
M4270_RS28015 (M4270_28005) | 27322..27579 | + | 258 | WP_000764642.1 | hypothetical protein | - |
M4270_RS28020 (M4270_28010) | 27637..28413 | - | 777 | WP_000015958.1 | site-specific integrase | - |
M4270_RS28025 (M4270_28015) | 28410..29153 | - | 744 | WP_000129823.1 | hypothetical protein | - |
M4270_RS28030 (M4270_28020) | 29204..29554 | - | 351 | WP_000493378.1 | hypothetical protein | - |
M4270_RS28035 (M4270_28025) | 29698..30159 | - | 462 | WP_072202616.1 | hypothetical protein | - |
M4270_RS28040 (M4270_28030) | 30116..30346 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M4270_RS28045 (M4270_28035) | 30343..30759 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4270_RS28050 (M4270_28040) | 30833..31522 | + | 690 | Protein_44 | AAA family ATPase | - |
M4270_RS28055 (M4270_28045) | 31577..32274 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
M4270_RS28060 (M4270_28050) | 32359..33219 | - | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
M4270_RS28065 (M4270_28055) | 33402..33719 | - | 318 | Protein_47 | recombinase family protein | - |
M4270_RS28070 (M4270_28060) | 33919..34743 | - | 825 | WP_000722315.1 | oxacillin-hydrolyzing class D beta-lactamase OXA-9 | - |
M4270_RS28075 (M4270_28065) | 34803..35591 | - | 789 | WP_001206315.1 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 | - | 1..70829 | 70829 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T244981 WP_001044770.1 NZ_CP097230:30343-30759 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |