Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 30116..30759 Replicon plasmid p70.8
Accession NZ_CP097230
Organism Klebsiella pneumoniae strain 5

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M4270_RS28045 Protein ID WP_001044770.1
Coordinates 30343..30759 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M4270_RS28040 Protein ID WP_001261282.1
Coordinates 30116..30346 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4270_RS28005 (M4270_27995) 25688..26554 - 867 WP_004118283.1 replication initiation protein -
M4270_RS28010 (M4270_28000) 27089..27193 + 105 WP_032409716.1 hypothetical protein -
M4270_RS28015 (M4270_28005) 27322..27579 + 258 WP_000764642.1 hypothetical protein -
M4270_RS28020 (M4270_28010) 27637..28413 - 777 WP_000015958.1 site-specific integrase -
M4270_RS28025 (M4270_28015) 28410..29153 - 744 WP_000129823.1 hypothetical protein -
M4270_RS28030 (M4270_28020) 29204..29554 - 351 WP_000493378.1 hypothetical protein -
M4270_RS28035 (M4270_28025) 29698..30159 - 462 WP_072202616.1 hypothetical protein -
M4270_RS28040 (M4270_28030) 30116..30346 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4270_RS28045 (M4270_28035) 30343..30759 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M4270_RS28050 (M4270_28040) 30833..31522 + 690 Protein_44 AAA family ATPase -
M4270_RS28055 (M4270_28045) 31577..32274 + 698 WP_223174630.1 IS1 family transposase -
M4270_RS28060 (M4270_28050) 32359..33219 - 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M4270_RS28065 (M4270_28055) 33402..33719 - 318 Protein_47 recombinase family protein -
M4270_RS28070 (M4270_28060) 33919..34743 - 825 WP_000722315.1 oxacillin-hydrolyzing class D beta-lactamase OXA-9 -
M4270_RS28075 (M4270_28065) 34803..35591 - 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 - 1..70829 70829


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T244981 WP_001044770.1 NZ_CP097230:30343-30759 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT244981 WP_001261282.1 NZ_CP097230:30116-30346 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References