Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 137687..138209 | Replicon | plasmid p390.4 |
Accession | NZ_CP097229 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A0C7KG00 |
Locus tag | M4270_RS26495 | Protein ID | WP_038991638.1 |
Coordinates | 137925..138209 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | M4270_RS26490 | Protein ID | WP_004181777.1 |
Coordinates | 137687..137935 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS26470 (M4270_26465) | 132896..133717 | - | 822 | WP_004181772.1 | hypothetical protein | - |
M4270_RS26475 (M4270_26470) | 133779..134132 | - | 354 | WP_004181774.1 | hypothetical protein | - |
M4270_RS26480 (M4270_26475) | 134277..135263 | - | 987 | WP_040120328.1 | hypothetical protein | - |
M4270_RS26485 (M4270_26480) | 135597..137396 | - | 1800 | WP_043907032.1 | ATP-dependent helicase | - |
M4270_RS26490 (M4270_26485) | 137687..137935 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M4270_RS26495 (M4270_26490) | 137925..138209 | + | 285 | WP_038991638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4270_RS26500 (M4270_26495) | 138226..138327 | - | 102 | Protein_146 | IS200/IS605 family transposase | - |
M4270_RS26505 (M4270_26500) | 138363..139589 | + | 1227 | WP_040120327.1 | RNA-guided endonuclease TnpB family protein | - |
M4270_RS26510 (M4270_26505) | 139861..140085 | - | 225 | Protein_148 | transposase | - |
M4270_RS26515 (M4270_26510) | 140164..140592 | - | 429 | WP_077256229.1 | IS200/IS605 family transposase | - |
M4270_RS26520 (M4270_26515) | 140628..141815 | + | 1188 | WP_043907031.1 | RNA-guided endonuclease TnpB family protein | - |
M4270_RS26525 (M4270_26520) | 141860..142231 | - | 372 | WP_044816264.1 | hypothetical protein | - |
M4270_RS26530 (M4270_26525) | 142228..142572 | - | 345 | WP_014386518.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaNDM-1 / aph(3')-VI / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 / dfrA14 / blaOXA-1 / aac(6')-Ib-cr / qnrB1 | htpB | 1..390420 | 390420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10993.73 Da Isoelectric Point: 10.6516
>T244979 WP_038991638.1 NZ_CP097229:137925-138209 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KG00 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |