Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/ElaA-DUF1778
Location 19588..20339 Replicon plasmid p390.4
Accession NZ_CP097229
Organism Klebsiella pneumoniae strain 5

Toxin (Protein)


Gene name ataT Uniprot ID H6U1U8
Locus tag M4270_RS25890 Protein ID WP_014386536.1
Coordinates 19857..20339 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A071LPN3
Locus tag M4270_RS25885 Protein ID WP_004902250.1
Coordinates 19588..19866 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4270_RS25850 (M4270_25845) 15231..15656 - 426 WP_000522996.1 organomercurial transporter MerC -
M4270_RS25855 (M4270_25850) 15684..15959 - 276 WP_043907009.1 mercury resistance system periplasmic binding protein MerP -
M4270_RS25860 (M4270_25855) 15975..16340 - 366 WP_004200999.1 mercuric ion transporter MerT -
M4270_RS25865 (M4270_25860) 16412..16867 + 456 WP_001166628.1 Hg(II)-responsive transcriptional regulator -
M4270_RS25870 (M4270_25865) 17520..17978 + 459 WP_014386535.1 hypothetical protein -
M4270_RS25875 (M4270_25870) 18808..19149 + 342 WP_004902257.1 hypothetical protein -
M4270_RS25880 (M4270_25875) 19257..19469 + 213 WP_004902255.1 hypothetical protein -
M4270_RS25885 (M4270_25880) 19588..19866 + 279 WP_004902250.1 DUF1778 domain-containing protein Antitoxin
M4270_RS25890 (M4270_25885) 19857..20339 + 483 WP_014386536.1 GNAT family N-acetyltransferase Toxin
M4270_RS25895 (M4270_25890) 21374..21913 + 540 WP_004902239.1 hypothetical protein -
M4270_RS25900 (M4270_25895) 22018..22410 + 393 WP_032442757.1 hypothetical protein -
M4270_RS25905 (M4270_25900) 22511..23266 + 756 WP_004902235.1 DUF2971 domain-containing protein -
M4270_RS25910 (M4270_25905) 23293..23940 + 648 WP_014386537.1 EcsC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaNDM-1 / aph(3')-VI / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 / dfrA14 / blaOXA-1 / aac(6')-Ib-cr / qnrB1 htpB 1..390420 390420


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(42-144)

Antitoxin

Vibrio phage ICP1, Orf50

(10-86)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17662.45 Da        Isoelectric Point: 8.9130

>T244978 WP_014386536.1 NZ_CP097229:19857-20339 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV

Download         Length: 483 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10704.23 Da        Isoelectric Point: 4.5271

>AT244978 WP_004902250.1 NZ_CP097229:19588-19866 [Klebsiella pneumoniae]
MKPDVREAPINIRAKTSQRDLIDMAASLVSKSRTDFMLEVACREAQDILLDQRLFLLNDNQFEAFIEELDAPITPERQAR
IDNLMNRKSPWE

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MBI1

Antitoxin

Source ID Structure
AlphaFold DB A0A071LPN3

References