Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4405537..4406194 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M4270_RS21265 | Protein ID | WP_004181233.1 |
Coordinates | 4405784..4406194 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M4270_RS21260 | Protein ID | WP_002916312.1 |
Coordinates | 4405537..4405803 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS21235 (4400693) | 4400693..4402126 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
M4270_RS21240 (4402245) | 4402245..4402973 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M4270_RS21245 (4403023) | 4403023..4403334 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M4270_RS21250 (4403498) | 4403498..4404157 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M4270_RS21255 (4404308) | 4404308..4405291 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M4270_RS21260 (4405537) | 4405537..4405803 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M4270_RS21265 (4405784) | 4405784..4406194 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
M4270_RS21270 (4406201) | 4406201..4406722 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
M4270_RS21275 (4406823) | 4406823..4407719 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M4270_RS21280 (4407742) | 4407742..4408455 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M4270_RS21285 (4408461) | 4408461..4410194 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T244977 WP_004181233.1 NZ_CP097228:4405784-4406194 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|