Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3499372..3499997 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | M4270_RS16835 | Protein ID | WP_002882817.1 |
Coordinates | 3499372..3499755 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | M4270_RS16840 | Protein ID | WP_004150355.1 |
Coordinates | 3499755..3499997 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS16820 (3496738) | 3496738..3497640 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
M4270_RS16825 (3497637) | 3497637..3498272 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
M4270_RS16830 (3498269) | 3498269..3499198 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
M4270_RS16835 (3499372) | 3499372..3499755 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4270_RS16840 (3499755) | 3499755..3499997 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
M4270_RS16845 (3500202) | 3500202..3501119 | + | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
M4270_RS16850 (3501133) | 3501133..3502074 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
M4270_RS16855 (3502119) | 3502119..3502556 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
M4270_RS16860 (3502553) | 3502553..3503413 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
M4270_RS16865 (3503407) | 3503407..3504006 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T244975 WP_002882817.1 NZ_CP097228:c3499755-3499372 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |