Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3030918..3031434 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M4270_RS14605 | Protein ID | WP_004178374.1 |
Coordinates | 3030918..3031202 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M4270_RS14610 | Protein ID | WP_002886901.1 |
Coordinates | 3031192..3031434 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS14580 (3026402) | 3026402..3026665 | - | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
M4270_RS14585 (3026795) | 3026795..3026968 | + | 174 | WP_032408826.1 | hypothetical protein | - |
M4270_RS14590 (3026971) | 3026971..3027714 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M4270_RS14595 (3028071) | 3028071..3030209 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M4270_RS14600 (3030450) | 3030450..3030914 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M4270_RS14605 (3030918) | 3030918..3031202 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4270_RS14610 (3031192) | 3031192..3031434 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M4270_RS14615 (3031512) | 3031512..3033422 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
M4270_RS14620 (3033445) | 3033445..3034599 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M4270_RS14625 (3034666) | 3034666..3035406 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T244973 WP_004178374.1 NZ_CP097228:c3031202-3030918 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |