Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 2920350..2921160 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | M4270_RS14165 | Protein ID | WP_004178461.1 |
Coordinates | 2920350..2920883 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | M4270_RS14170 | Protein ID | WP_002887278.1 |
Coordinates | 2920894..2921160 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS14160 (2919181) | 2919181..2920302 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
M4270_RS14165 (2920350) | 2920350..2920883 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
M4270_RS14170 (2920894) | 2920894..2921160 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
M4270_RS14175 (2921263) | 2921263..2922696 | - | 1434 | WP_004178459.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
M4270_RS14180 (2922686) | 2922686..2923369 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
M4270_RS14185 (2923541) | 2923541..2924926 | + | 1386 | WP_004178457.1 | efflux transporter outer membrane subunit | - |
M4270_RS14190 (2924944) | 2924944..2925288 | + | 345 | WP_004197273.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T244972 WP_004178461.1 NZ_CP097228:c2920883-2920350 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLZ1 |