Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2325774..2326393 Replicon chromosome
Accession NZ_CP097228
Organism Klebsiella pneumoniae strain 5

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4270_RS11330 Protein ID WP_002892050.1
Coordinates 2326175..2326393 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4270_RS11325 Protein ID WP_002892066.1
Coordinates 2325774..2326148 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4270_RS11315 (2320926) 2320926..2322119 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4270_RS11320 (2322142) 2322142..2325288 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4270_RS11325 (2325774) 2325774..2326148 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4270_RS11330 (2326175) 2326175..2326393 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4270_RS11335 (2326552) 2326552..2327118 + 567 WP_002892030.1 maltose O-acetyltransferase -
M4270_RS11340 (2327090) 2327090..2327230 - 141 WP_004147370.1 hypothetical protein -
M4270_RS11345 (2327251) 2327251..2327721 + 471 WP_002892026.1 YlaC family protein -
M4270_RS11350 (2327696) 2327696..2329147 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4270_RS11355 (2329248) 2329248..2329946 + 699 WP_004178762.1 GNAT family protein -
M4270_RS11360 (2329943) 2329943..2330083 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4270_RS11365 (2330083) 2330083..2330346 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244971 WP_002892050.1 NZ_CP097228:2326175-2326393 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244971 WP_002892066.1 NZ_CP097228:2325774-2326148 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References