Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2325774..2326393 | Replicon | chromosome |
Accession | NZ_CP097228 | ||
Organism | Klebsiella pneumoniae strain 5 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | M4270_RS11330 | Protein ID | WP_002892050.1 |
Coordinates | 2326175..2326393 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | M4270_RS11325 | Protein ID | WP_002892066.1 |
Coordinates | 2325774..2326148 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4270_RS11315 (2320926) | 2320926..2322119 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M4270_RS11320 (2322142) | 2322142..2325288 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
M4270_RS11325 (2325774) | 2325774..2326148 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
M4270_RS11330 (2326175) | 2326175..2326393 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
M4270_RS11335 (2326552) | 2326552..2327118 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
M4270_RS11340 (2327090) | 2327090..2327230 | - | 141 | WP_004147370.1 | hypothetical protein | - |
M4270_RS11345 (2327251) | 2327251..2327721 | + | 471 | WP_002892026.1 | YlaC family protein | - |
M4270_RS11350 (2327696) | 2327696..2329147 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
M4270_RS11355 (2329248) | 2329248..2329946 | + | 699 | WP_004178762.1 | GNAT family protein | - |
M4270_RS11360 (2329943) | 2329943..2330083 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
M4270_RS11365 (2330083) | 2330083..2330346 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244971 WP_002892050.1 NZ_CP097228:2326175-2326393 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244971 WP_002892066.1 NZ_CP097228:2325774-2326148 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |