Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 61726..62369 | Replicon | plasmid p122.3 |
Accession | NZ_CP097225 | ||
Organism | Klebsiella pneumoniae strain 11 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | M4271_RS27375 | Protein ID | WP_001044770.1 |
Coordinates | 61953..62369 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | M4271_RS27370 | Protein ID | WP_001261282.1 |
Coordinates | 61726..61956 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4271_RS27335 (M4271_27335) | 57298..58164 | - | 867 | WP_004118283.1 | replication initiation protein | - |
M4271_RS27340 (M4271_27340) | 58699..58803 | + | 105 | WP_032409716.1 | hypothetical protein | - |
M4271_RS27345 (M4271_27345) | 58932..59189 | + | 258 | WP_000764642.1 | hypothetical protein | - |
M4271_RS27350 (M4271_27350) | 59247..60023 | - | 777 | WP_000015958.1 | site-specific integrase | - |
M4271_RS27355 (M4271_27355) | 60020..60763 | - | 744 | WP_000129823.1 | hypothetical protein | - |
M4271_RS27360 (M4271_27360) | 60814..61164 | - | 351 | WP_000493378.1 | hypothetical protein | - |
M4271_RS27365 (M4271_27365) | 61308..61769 | - | 462 | WP_072202616.1 | hypothetical protein | - |
M4271_RS27370 (M4271_27370) | 61726..61956 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M4271_RS27375 (M4271_27375) | 61953..62369 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4271_RS27380 (M4271_27380) | 62443..63132 | + | 690 | Protein_69 | AAA family ATPase | - |
M4271_RS27385 (M4271_27385) | 63187..63884 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
M4271_RS27390 (M4271_27390) | 63969..64829 | - | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
M4271_RS27395 (M4271_27395) | 65012..65329 | - | 318 | Protein_72 | recombinase family protein | - |
M4271_RS27400 (M4271_27400) | 65529..66353 | - | 825 | WP_000722315.1 | oxacillin-hydrolyzing class D beta-lactamase OXA-9 | - |
M4271_RS27405 (M4271_27405) | 66413..67201 | - | 789 | WP_001206315.1 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / blaOXA-1 / aac(6')-Ib-cr / qnrB1 | - | 1..122319 | 122319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T244964 WP_001044770.1 NZ_CP097225:61953-62369 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |