Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 61726..62369 Replicon plasmid p122.3
Accession NZ_CP097225
Organism Klebsiella pneumoniae strain 11

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M4271_RS27375 Protein ID WP_001044770.1
Coordinates 61953..62369 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M4271_RS27370 Protein ID WP_001261282.1
Coordinates 61726..61956 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4271_RS27335 (M4271_27335) 57298..58164 - 867 WP_004118283.1 replication initiation protein -
M4271_RS27340 (M4271_27340) 58699..58803 + 105 WP_032409716.1 hypothetical protein -
M4271_RS27345 (M4271_27345) 58932..59189 + 258 WP_000764642.1 hypothetical protein -
M4271_RS27350 (M4271_27350) 59247..60023 - 777 WP_000015958.1 site-specific integrase -
M4271_RS27355 (M4271_27355) 60020..60763 - 744 WP_000129823.1 hypothetical protein -
M4271_RS27360 (M4271_27360) 60814..61164 - 351 WP_000493378.1 hypothetical protein -
M4271_RS27365 (M4271_27365) 61308..61769 - 462 WP_072202616.1 hypothetical protein -
M4271_RS27370 (M4271_27370) 61726..61956 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4271_RS27375 (M4271_27375) 61953..62369 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M4271_RS27380 (M4271_27380) 62443..63132 + 690 Protein_69 AAA family ATPase -
M4271_RS27385 (M4271_27385) 63187..63884 + 698 WP_223174630.1 IS1 family transposase -
M4271_RS27390 (M4271_27390) 63969..64829 - 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M4271_RS27395 (M4271_27395) 65012..65329 - 318 Protein_72 recombinase family protein -
M4271_RS27400 (M4271_27400) 65529..66353 - 825 WP_000722315.1 oxacillin-hydrolyzing class D beta-lactamase OXA-9 -
M4271_RS27405 (M4271_27405) 66413..67201 - 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / blaOXA-1 / aac(6')-Ib-cr / qnrB1 - 1..122319 122319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T244964 WP_001044770.1 NZ_CP097225:61953-62369 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT244964 WP_001261282.1 NZ_CP097225:61726-61956 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References