Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 211583..212105 Replicon plasmid p235.4
Accession NZ_CP097224
Organism Klebsiella pneumoniae strain 11

Toxin (Protein)


Gene name stbE Uniprot ID A0A0C7KG00
Locus tag M4271_RS26925 Protein ID WP_038991638.1
Coordinates 211821..212105 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID A0A2J4R0U8
Locus tag M4271_RS26920 Protein ID WP_004181777.1
Coordinates 211583..211831 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4271_RS26900 (M4271_26900) 206792..207613 - 822 WP_004181772.1 hypothetical protein -
M4271_RS26905 (M4271_26905) 207675..208028 - 354 WP_004181774.1 hypothetical protein -
M4271_RS26910 (M4271_26910) 208173..209159 - 987 WP_040120328.1 hypothetical protein -
M4271_RS26915 (M4271_26915) 209493..211292 - 1800 WP_043907032.1 ATP-dependent helicase -
M4271_RS26920 (M4271_26920) 211583..211831 + 249 WP_004181777.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M4271_RS26925 (M4271_26925) 211821..212105 + 285 WP_038991638.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M4271_RS26930 (M4271_26930) 212122..212223 - 102 Protein_232 IS200/IS605 family transposase -
M4271_RS26935 (M4271_26935) 212259..213485 + 1227 WP_040120327.1 RNA-guided endonuclease TnpB family protein -
M4271_RS26940 (M4271_26940) 213757..213981 - 225 Protein_234 transposase -
M4271_RS26945 (M4271_26945) 214060..214488 - 429 WP_077256229.1 IS200/IS605 family transposase -
M4271_RS26950 (M4271_26950) 214524..215711 + 1188 WP_043907031.1 RNA-guided endonuclease TnpB family protein -
M4271_RS26955 (M4271_26955) 215756..216127 - 372 WP_044816264.1 hypothetical protein -
M4271_RS26960 (M4271_26960) 216124..216468 - 345 WP_014386518.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid dfrA14 / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-VI / blaNDM-1 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 - 1..235390 235390


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10993.73 Da        Isoelectric Point: 10.6516

>T244962 WP_038991638.1 NZ_CP097224:211821-212105 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYHLTKHRN

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8925.17 Da        Isoelectric Point: 3.8209

>AT244962 WP_004181777.1 NZ_CP097224:211583-211831 [Klebsiella pneumoniae]
MAFQVLTTTAASITELKRDPMGTFNAGEGAPVAILNRNEPAFYCVPPALYAQLMELLEDQELGRIADERIGEAVIEVSLD
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C7KG00

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4R0U8

References