Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 92630..93381 | Replicon | plasmid p235.4 |
Accession | NZ_CP097224 | ||
Organism | Klebsiella pneumoniae strain 11 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | M4271_RS26305 | Protein ID | WP_014386536.1 |
Coordinates | 92899..93381 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | M4271_RS26300 | Protein ID | WP_004902250.1 |
Coordinates | 92630..92908 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4271_RS26265 (M4271_26265) | 88273..88698 | - | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
M4271_RS26270 (M4271_26270) | 88726..89001 | - | 276 | WP_043907009.1 | mercury resistance system periplasmic binding protein MerP | - |
M4271_RS26275 (M4271_26275) | 89017..89382 | - | 366 | WP_004200999.1 | mercuric ion transporter MerT | - |
M4271_RS26280 (M4271_26280) | 89454..89909 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
M4271_RS26285 (M4271_26285) | 90562..91020 | + | 459 | WP_014386535.1 | hypothetical protein | - |
M4271_RS26290 (M4271_26290) | 91850..92191 | + | 342 | WP_004902257.1 | hypothetical protein | - |
M4271_RS26295 (M4271_26295) | 92299..92511 | + | 213 | WP_004902255.1 | hypothetical protein | - |
M4271_RS26300 (M4271_26300) | 92630..92908 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
M4271_RS26305 (M4271_26305) | 92899..93381 | + | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
M4271_RS26310 (M4271_26310) | 94416..94955 | + | 540 | WP_004902239.1 | hypothetical protein | - |
M4271_RS26315 (M4271_26315) | 95060..95452 | + | 393 | WP_032442757.1 | hypothetical protein | - |
M4271_RS26320 (M4271_26320) | 95553..96308 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
M4271_RS26325 (M4271_26325) | 96335..96982 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA14 / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-VI / blaNDM-1 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..235390 | 235390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T244961 WP_014386536.1 NZ_CP097224:92899-93381 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |