Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4411273..4411930 | Replicon | chromosome |
Accession | NZ_CP097223 | ||
Organism | Klebsiella pneumoniae strain 11 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M4271_RS21285 | Protein ID | WP_004181233.1 |
Coordinates | 4411520..4411930 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M4271_RS21280 | Protein ID | WP_002916312.1 |
Coordinates | 4411273..4411539 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4271_RS21255 (4406429) | 4406429..4407862 | - | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
M4271_RS21260 (4407981) | 4407981..4408709 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
M4271_RS21265 (4408759) | 4408759..4409070 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M4271_RS21270 (4409234) | 4409234..4409893 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M4271_RS21275 (4410044) | 4410044..4411027 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M4271_RS21280 (4411273) | 4411273..4411539 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M4271_RS21285 (4411520) | 4411520..4411930 | + | 411 | WP_004181233.1 | protein YgfX | Toxin |
M4271_RS21290 (4411937) | 4411937..4412458 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
M4271_RS21295 (4412559) | 4412559..4413455 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M4271_RS21300 (4413478) | 4413478..4414191 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M4271_RS21305 (4414197) | 4414197..4415930 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T244960 WP_004181233.1 NZ_CP097223:4411520-4411930 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|