Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3036654..3037170 | Replicon | chromosome |
| Accession | NZ_CP097223 | ||
| Organism | Klebsiella pneumoniae strain 11 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M4271_RS14630 | Protein ID | WP_004178374.1 |
| Coordinates | 3036654..3036938 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M4271_RS14635 | Protein ID | WP_002886901.1 |
| Coordinates | 3036928..3037170 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4271_RS14605 (3032138) | 3032138..3032446 | - | 309 | WP_004178377.1 | PTS sugar transporter subunit IIB | - |
| M4271_RS14610 (3032531) | 3032531..3032704 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| M4271_RS14615 (3032707) | 3032707..3033450 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M4271_RS14620 (3033807) | 3033807..3035945 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M4271_RS14625 (3036186) | 3036186..3036650 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M4271_RS14630 (3036654) | 3036654..3036938 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4271_RS14635 (3036928) | 3036928..3037170 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M4271_RS14640 (3037248) | 3037248..3039158 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
| M4271_RS14645 (3039181) | 3039181..3040335 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| M4271_RS14650 (3040402) | 3040402..3041142 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T244956 WP_004178374.1 NZ_CP097223:c3036938-3036654 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |