Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2331510..2332129 Replicon chromosome
Accession NZ_CP097223
Organism Klebsiella pneumoniae strain 11

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4271_RS11355 Protein ID WP_002892050.1
Coordinates 2331911..2332129 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4271_RS11350 Protein ID WP_002892066.1
Coordinates 2331510..2331884 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4271_RS11340 (2326662) 2326662..2327855 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4271_RS11345 (2327878) 2327878..2331024 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4271_RS11350 (2331510) 2331510..2331884 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4271_RS11355 (2331911) 2331911..2332129 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4271_RS11360 (2332288) 2332288..2332854 + 567 WP_002892030.1 maltose O-acetyltransferase -
M4271_RS11365 (2332826) 2332826..2332966 - 141 WP_004147370.1 hypothetical protein -
M4271_RS11370 (2332987) 2332987..2333457 + 471 WP_002892026.1 YlaC family protein -
M4271_RS11375 (2333432) 2333432..2334883 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4271_RS11380 (2334984) 2334984..2335682 + 699 WP_004178762.1 GNAT family protein -
M4271_RS11385 (2335679) 2335679..2335819 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4271_RS11390 (2335819) 2335819..2336082 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244954 WP_002892050.1 NZ_CP097223:2331911-2332129 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244954 WP_002892066.1 NZ_CP097223:2331510-2331884 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References