Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 106370..107013 Replicon plasmid p206.6
Accession NZ_CP097221
Organism Klebsiella pneumoniae strain 12

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M4272_RS26340 Protein ID WP_001044770.1
Coordinates 106370..106786 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M4272_RS26345 Protein ID WP_001261282.1
Coordinates 106783..107013 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4272_RS26310 (M4272_26310) 101538..102326 + 789 WP_001206315.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -
M4272_RS26315 (M4272_26315) 102386..103210 + 825 WP_000722315.1 oxacillin-hydrolyzing class D beta-lactamase OXA-9 -
M4272_RS26320 (M4272_26320) 103410..103727 + 318 Protein_108 recombinase family protein -
M4272_RS26325 (M4272_26325) 103910..104770 + 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M4272_RS26335 (M4272_26335) 105607..106296 - 690 Protein_111 AAA family ATPase -
M4272_RS26340 (M4272_26340) 106370..106786 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M4272_RS26345 (M4272_26345) 106783..107013 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4272_RS26350 (M4272_26350) 106970..107431 + 462 WP_072202616.1 hypothetical protein -
M4272_RS26355 (M4272_26355) 107575..107925 + 351 WP_000493378.1 hypothetical protein -
M4272_RS26360 (M4272_26360) 107976..108719 + 744 WP_000129823.1 hypothetical protein -
M4272_RS26365 (M4272_26365) 108716..109492 + 777 WP_000015958.1 site-specific integrase -
M4272_RS26370 (M4272_26370) 109550..109807 - 258 WP_000764642.1 hypothetical protein -
M4272_RS26375 (M4272_26375) 109936..110040 - 105 WP_032409716.1 hypothetical protein -
M4272_RS26380 (M4272_26380) 110575..111441 + 867 WP_004118283.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1A / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 - 1..206564 206564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T244946 WP_001044770.1 NZ_CP097221:c106786-106370 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT244946 WP_001261282.1 NZ_CP097221:c107013-106783 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References