Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 78957..79708 | Replicon | plasmid p206.6 |
| Accession | NZ_CP097221 | ||
| Organism | Klebsiella pneumoniae strain 12 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | M4272_RS26170 | Protein ID | WP_014386536.1 |
| Coordinates | 78957..79439 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | M4272_RS26175 | Protein ID | WP_004902250.1 |
| Coordinates | 79430..79708 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4272_RS26150 (M4272_26150) | 75356..76003 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| M4272_RS26155 (M4272_26155) | 76030..76785 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| M4272_RS26160 (M4272_26160) | 76886..77278 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| M4272_RS26165 (M4272_26165) | 77383..77922 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| M4272_RS26170 (M4272_26170) | 78957..79439 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| M4272_RS26175 (M4272_26175) | 79430..79708 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| M4272_RS26180 (M4272_26180) | 79827..80039 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| M4272_RS26185 (M4272_26185) | 80147..80488 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| M4272_RS26190 (M4272_26190) | 81318..81776 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| M4272_RS26195 (M4272_26195) | 82429..82884 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| M4272_RS26200 (M4272_26200) | 82956..83321 | + | 366 | WP_004200999.1 | mercuric ion transporter MerT | - |
| M4272_RS26205 (M4272_26205) | 83337..83612 | + | 276 | WP_043907009.1 | mercury resistance system periplasmic binding protein MerP | - |
| M4272_RS26210 (M4272_26210) | 83640..84065 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1A / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 | - | 1..206564 | 206564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T244945 WP_014386536.1 NZ_CP097221:c79439-78957 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |