Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ataRT/ElaA-DUF1778
Location 78957..79708 Replicon plasmid p206.6
Accession NZ_CP097221
Organism Klebsiella pneumoniae strain 12

Toxin (Protein)


Gene name ataT Uniprot ID H6U1U8
Locus tag M4272_RS26170 Protein ID WP_014386536.1
Coordinates 78957..79439 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name ataR Uniprot ID A0A071LPN3
Locus tag M4272_RS26175 Protein ID WP_004902250.1
Coordinates 79430..79708 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4272_RS26150 (M4272_26150) 75356..76003 - 648 WP_014386537.1 EcsC family protein -
M4272_RS26155 (M4272_26155) 76030..76785 - 756 WP_004902235.1 DUF2971 domain-containing protein -
M4272_RS26160 (M4272_26160) 76886..77278 - 393 WP_032442757.1 hypothetical protein -
M4272_RS26165 (M4272_26165) 77383..77922 - 540 WP_004902239.1 hypothetical protein -
M4272_RS26170 (M4272_26170) 78957..79439 - 483 WP_014386536.1 GNAT family N-acetyltransferase Toxin
M4272_RS26175 (M4272_26175) 79430..79708 - 279 WP_004902250.1 DUF1778 domain-containing protein Antitoxin
M4272_RS26180 (M4272_26180) 79827..80039 - 213 WP_004902255.1 hypothetical protein -
M4272_RS26185 (M4272_26185) 80147..80488 - 342 WP_004902257.1 hypothetical protein -
M4272_RS26190 (M4272_26190) 81318..81776 - 459 WP_014386535.1 hypothetical protein -
M4272_RS26195 (M4272_26195) 82429..82884 - 456 WP_001166628.1 Hg(II)-responsive transcriptional regulator -
M4272_RS26200 (M4272_26200) 82956..83321 + 366 WP_004200999.1 mercuric ion transporter MerT -
M4272_RS26205 (M4272_26205) 83337..83612 + 276 WP_043907009.1 mercury resistance system periplasmic binding protein MerP -
M4272_RS26210 (M4272_26210) 83640..84065 + 426 WP_000522996.1 organomercurial transporter MerC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-15 / aac(6')-Ib / ant(3'')-Ia / blaOXA-9 / blaTEM-1A / aac(3)-IId / blaSHV-187 / ARR-3 / ere(A) / cmlA1 / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 - 1..206564 206564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(42-144)

Antitoxin

Vibrio phage ICP1, Orf50

(10-86)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17662.45 Da        Isoelectric Point: 8.9130

>T244945 WP_014386536.1 NZ_CP097221:c79439-78957 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV

Download         Length: 483 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10704.23 Da        Isoelectric Point: 4.5271

>AT244945 WP_004902250.1 NZ_CP097221:c79708-79430 [Klebsiella pneumoniae]
MKPDVREAPINIRAKTSQRDLIDMAASLVSKSRTDFMLEVACREAQDILLDQRLFLLNDNQFEAFIEELDAPITPERQAR
IDNLMNRKSPWE

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A5MBI1

Antitoxin

Source ID Structure
AlphaFold DB A0A071LPN3

References