Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4905025..4905541 | Replicon | chromosome |
Accession | NZ_CP097220 | ||
Organism | Klebsiella pneumoniae strain 12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | M4272_RS23800 | Protein ID | WP_004178374.1 |
Coordinates | 4905257..4905541 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M4272_RS23795 | Protein ID | WP_002886901.1 |
Coordinates | 4905025..4905267 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4272_RS23780 (4901053) | 4901053..4901793 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
M4272_RS23785 (4901860) | 4901860..4903014 | + | 1155 | WP_004178372.1 | lactonase family protein | - |
M4272_RS23790 (4903037) | 4903037..4904947 | + | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
M4272_RS23795 (4905025) | 4905025..4905267 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M4272_RS23800 (4905257) | 4905257..4905541 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M4272_RS23805 (4905545) | 4905545..4906009 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M4272_RS23810 (4906250) | 4906250..4908388 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M4272_RS23815 (4908745) | 4908745..4909488 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M4272_RS23820 (4909491) | 4909491..4909664 | - | 174 | WP_032408826.1 | hypothetical protein | - |
M4272_RS23825 (4909794) | 4909794..4910057 | + | 264 | WP_228985702.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T244943 WP_004178374.1 NZ_CP097220:4905257-4905541 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |