Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3530416..3531073 | Replicon | chromosome |
| Accession | NZ_CP097220 | ||
| Organism | Klebsiella pneumoniae strain 12 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M4272_RS17150 | Protein ID | WP_004181233.1 |
| Coordinates | 3530416..3530826 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M4272_RS17155 | Protein ID | WP_002916312.1 |
| Coordinates | 3530807..3531073 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4272_RS17130 (3526416) | 3526416..3528149 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M4272_RS17135 (3528155) | 3528155..3528868 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M4272_RS17140 (3528891) | 3528891..3529787 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M4272_RS17145 (3529888) | 3529888..3530409 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| M4272_RS17150 (3530416) | 3530416..3530826 | - | 411 | WP_004181233.1 | protein YgfX | Toxin |
| M4272_RS17155 (3530807) | 3530807..3531073 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M4272_RS17160 (3531319) | 3531319..3532302 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| M4272_RS17165 (3532453) | 3532453..3533112 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| M4272_RS17170 (3533276) | 3533276..3533587 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| M4272_RS17175 (3533637) | 3533637..3534365 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| M4272_RS17180 (3534484) | 3534484..3535917 | + | 1434 | WP_004181234.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16121.92 Da Isoelectric Point: 11.1565
>T244939 WP_004181233.1 NZ_CP097220:c3530826-3530416 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAEEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|