Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 263840..264459 Replicon chromosome
Accession NZ_CP097220
Organism Klebsiella pneumoniae strain 12

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4272_RS01300 Protein ID WP_002892050.1
Coordinates 263840..264058 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4272_RS01305 Protein ID WP_002892066.1
Coordinates 264085..264459 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4272_RS01265 (259887) 259887..260150 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
M4272_RS01270 (260150) 260150..260290 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4272_RS01275 (260287) 260287..260985 - 699 WP_004178762.1 GNAT family protein -
M4272_RS01280 (261086) 261086..262537 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M4272_RS01285 (262512) 262512..262982 - 471 WP_002892026.1 YlaC family protein -
M4272_RS01290 (263003) 263003..263143 + 141 WP_004147370.1 hypothetical protein -
M4272_RS01295 (263115) 263115..263681 - 567 WP_002892030.1 maltose O-acetyltransferase -
M4272_RS01300 (263840) 263840..264058 - 219 WP_002892050.1 HHA domain-containing protein Toxin
M4272_RS01305 (264085) 264085..264459 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4272_RS01310 (264945) 264945..268091 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4272_RS01315 (268114) 268114..269307 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244932 WP_002892050.1 NZ_CP097220:c264058-263840 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244932 WP_002892066.1 NZ_CP097220:c264459-264085 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References