Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 103722..104365 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097214 | ||
| Organism | Escherichia coli strain BE311 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | M3O69_RS23970 | Protein ID | WP_001044768.1 |
| Coordinates | 103949..104365 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | M3O69_RS23965 | Protein ID | WP_001261287.1 |
| Coordinates | 103722..103952 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3O69_RS23960 (100297) | 100297..103416 | - | 3120 | WP_000467135.1 | hypothetical protein | - |
| M3O69_RS23965 (103722) | 103722..103952 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3O69_RS23970 (103949) | 103949..104365 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3O69_RS23975 (104527) | 104527..106665 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
| M3O69_RS23980 (107019) | 107019..107276 | + | 258 | WP_000371887.1 | hypothetical protein | - |
| M3O69_RS23985 (107276) | 107276..107866 | + | 591 | WP_000194548.1 | hypothetical protein | - |
| M3O69_RS23990 (107884) | 107884..108231 | - | 348 | WP_000142443.1 | DUF6404 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | paa | 1..113297 | 113297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T244930 WP_001044768.1 NZ_CP097214:103949-104365 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |