Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 75418..76043 | Replicon | plasmid unnamed1 |
Accession | NZ_CP097214 | ||
Organism | Escherichia coli strain BE311 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3O69_RS23840 | Protein ID | WP_000911314.1 |
Coordinates | 75418..75816 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | M3O69_RS23845 | Protein ID | WP_000450532.1 |
Coordinates | 75816..76043 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3O69_RS23825 (71749) | 71749..72258 | + | 510 | WP_000628103.1 | conjugal transfer entry exclusion protein TraS | - |
M3O69_RS23830 (72272) | 72272..73003 | + | 732 | WP_000850426.1 | conjugal transfer complement resistance protein TraT | - |
M3O69_RS23835 (73256) | 73256..75409 | + | 2154 | WP_001375140.1 | type IV conjugative transfer system coupling protein TraD | - |
M3O69_RS23840 (75418) | 75418..75816 | - | 399 | WP_000911314.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3O69_RS23845 (75816) | 75816..76043 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | paa | 1..113297 | 113297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14814.12 Da Isoelectric Point: 7.8604
>T244929 WP_000911314.1 NZ_CP097214:c75816-75418 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|