Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | KacT-ataR/ElaA-DUF1778 |
| Location | 27788..28591 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097214 | ||
| Organism | Escherichia coli strain BE311 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | M3O69_RS23530 | Protein ID | WP_000348879.1 |
| Coordinates | 28061..28591 (+) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | M3O69_RS23525 | Protein ID | WP_000114669.1 |
| Coordinates | 27788..28057 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3O69_RS23500 (24207) | 24207..24893 | + | 687 | WP_001031857.1 | fimbrial chaperone | - |
| M3O69_RS23505 (24893) | 24893..25894 | + | 1002 | WP_000792596.1 | protein FanF | - |
| M3O69_RS23510 (25894) | 25894..26418 | + | 525 | WP_000737845.1 | spore coat protein U domain-containing protein | - |
| M3O69_RS23515 (26411) | 26411..26938 | + | 528 | WP_000592915.1 | hypothetical protein | - |
| M3O69_RS23520 (27099) | 27099..27595 | + | 497 | Protein_32 | tyrosine-type recombinase/integrase | - |
| M3O69_RS23525 (27788) | 27788..28057 | + | 270 | WP_000114669.1 | DUF1778 domain-containing protein | Antitoxin |
| M3O69_RS23530 (28061) | 28061..28591 | + | 531 | WP_000348879.1 | GNAT family N-acetyltransferase | Toxin |
| M3O69_RS23535 (29103) | 29103..29321 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| M3O69_RS23540 (29323) | 29323..29628 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| M3O69_RS23545 (29629) | 29629..30435 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| M3O69_RS23550 (31157) | 31157..31483 | + | 327 | Protein_38 | RepB family plasmid replication initiator protein | - |
| M3O69_RS23560 (32808) | 32808..33248 | + | 441 | Protein_40 | RepB family plasmid replication initiator protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | paa | 1..113297 | 113297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20402.29 Da Isoelectric Point: 6.6389
>T244924 WP_000348879.1 NZ_CP097214:28061-28591 [Escherichia coli]
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKNLHRQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRMGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKNLHRQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRMGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|