Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1911558..1912389 Replicon chromosome
Accession NZ_CP097213
Organism Escherichia coli strain BE311

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag M3O69_RS09185 Protein ID WP_000854814.1
Coordinates 1911558..1911932 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag M3O69_RS09190 Protein ID WP_001285585.1
Coordinates 1912021..1912389 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3O69_RS09145 (1906953) 1906953..1908119 + 1167 WP_001375226.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M3O69_RS09150 (1908238) 1908238..1908711 + 474 WP_001105414.1 DNA gyrase inhibitor SbmC -
M3O69_RS09155 (1908910) 1908910..1909968 + 1059 WP_001200891.1 FUSC family protein -
M3O69_RS09160 (1910140) 1910140..1910469 + 330 WP_000450409.1 DUF496 family protein -
M3O69_RS09165 (1910570) 1910570..1910704 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
M3O69_RS09170 (1910824) 1910824..1910952 + 129 Protein_1792 transposase domain-containing protein -
M3O69_RS09175 (1911241) 1911241..1911321 - 81 Protein_1793 hypothetical protein -
M3O69_RS09180 (1911367) 1911367..1911561 - 195 WP_000988600.1 DUF5983 family protein -
M3O69_RS09185 (1911558) 1911558..1911932 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M3O69_RS09190 (1912021) 1912021..1912389 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M3O69_RS09195 (1912463) 1912463..1912684 - 222 WP_000692323.1 DUF987 domain-containing protein -
M3O69_RS09200 (1912747) 1912747..1913223 - 477 WP_001186726.1 RadC family protein -
M3O69_RS09205 (1913239) 1913239..1913718 - 480 WP_000860076.1 antirestriction protein -
M3O69_RS09210 (1913800) 1913800..1914618 - 819 WP_001234728.1 DUF932 domain-containing protein -
M3O69_RS09215 (1914838) 1914838..1915248 - 411 WP_000846713.1 hypothetical protein -
M3O69_RS09220 (1915264) 1915264..1915374 - 111 Protein_1802 DNA polymerase III subunit gamma/tau -
M3O69_RS09225 (1915460) 1915460..1916206 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T244912 WP_000854814.1 NZ_CP097213:c1911932-1911558 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT244912 WP_001285585.1 NZ_CP097213:c1912389-1912021 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References