Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1292755..1293672 | Replicon | chromosome |
Accession | NZ_CP097208 | ||
Organism | Bacillus velezensis strain N3 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | M2893_RS06735 | Protein ID | WP_003154806.1 |
Coordinates | 1292926..1293672 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M2893_RS06730 | Protein ID | WP_003154807.1 |
Coordinates | 1292755..1292925 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2893_RS06690 (1287987) | 1287987..1289609 | + | 1623 | WP_063174222.1 | pyocin knob domain-containing protein | - |
M2893_RS06695 (1289622) | 1289622..1289993 | + | 372 | WP_014304856.1 | XkdW family protein | - |
M2893_RS06700 (1289999) | 1289999..1290196 | + | 198 | WP_003154819.1 | XkdX family protein | - |
M2893_RS06705 (1290253) | 1290253..1291014 | + | 762 | WP_063174221.1 | hypothetical protein | - |
M2893_RS06710 (1291066) | 1291066..1291329 | + | 264 | WP_032866112.1 | hemolysin XhlA family protein | - |
M2893_RS06715 (1291343) | 1291343..1291606 | + | 264 | WP_003154813.1 | phage holin | - |
M2893_RS06720 (1291620) | 1291620..1292498 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
M2893_RS06725 (1292533) | 1292533..1292658 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M2893_RS06730 (1292755) | 1292755..1292925 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M2893_RS06735 (1292926) | 1292926..1293672 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M2893_RS06740 (1293777) | 1293777..1294775 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
M2893_RS06745 (1294788) | 1294788..1295405 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
M2893_RS06750 (1295691) | 1295691..1297007 | - | 1317 | WP_003154801.1 | amino acid permease | - |
M2893_RS06755 (1297330) | 1297330..1298280 | + | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T244901 WP_003154806.1 NZ_CP097208:c1293672-1292926 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8LGT8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |