Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 510589..511226 | Replicon | chromosome |
Accession | NZ_CP097208 | ||
Organism | Bacillus velezensis strain N3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M2893_RS02475 | Protein ID | WP_003156187.1 |
Coordinates | 510876..511226 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M2893_RS02470 | Protein ID | WP_003156188.1 |
Coordinates | 510589..510870 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2893_RS02450 (506954) | 506954..507553 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
M2893_RS02455 (507646) | 507646..508011 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
M2893_RS02460 (508176) | 508176..509183 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
M2893_RS02465 (509300) | 509300..510469 | + | 1170 | WP_003156189.1 | alanine racemase | - |
M2893_RS02470 (510589) | 510589..510870 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M2893_RS02475 (510876) | 510876..511226 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M2893_RS02480 (511344) | 511344..512165 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
M2893_RS02485 (512170) | 512170..512535 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M2893_RS02490 (512538) | 512538..512939 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M2893_RS02495 (512951) | 512951..513958 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
M2893_RS02500 (514022) | 514022..514351 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M2893_RS02505 (514348) | 514348..514830 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
M2893_RS02510 (514796) | 514796..515584 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
M2893_RS02515 (515584) | 515584..516186 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T244900 WP_003156187.1 NZ_CP097208:510876-511226 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|