Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 30557..31079 Replicon plasmid p652-4
Accession NZ_CP097194
Organism Klebsiella pneumoniae strain 15-652

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag M4I39_RS28415 Protein ID WP_000220560.1
Coordinates 30557..30838 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag M4I39_RS28420 Protein ID WP_000121743.1
Coordinates 30828..31079 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I39_RS28370 (M4I39_28340) 25566..26057 - 492 WP_000872475.1 transcription termination/antitermination NusG family protein -
M4I39_RS28375 (M4I39_28345) 26418..27575 - 1158 WP_000538023.1 DNA distortion polypeptide 2 -
M4I39_RS28380 (M4I39_28350) 27578..28123 - 546 WP_038976855.1 DNA distortion polypeptide 1 -
M4I39_RS28385 (M4I39_28355) 28450..28722 - 273 WP_000160399.1 hypothetical protein -
M4I39_RS28390 (M4I39_28360) 28735..28884 - 150 WP_000003880.1 hypothetical protein -
M4I39_RS28395 (M4I39_28365) 29171..29500 - 330 WP_000866648.1 hypothetical protein -
M4I39_RS28400 (M4I39_28370) 29593..29808 - 216 WP_001180116.1 hypothetical protein -
M4I39_RS28405 (M4I39_28375) 29798..30043 - 246 WP_000356546.1 hypothetical protein -
M4I39_RS28410 (M4I39_28380) 30088..30411 - 324 WP_001181903.1 hypothetical protein -
M4I39_RS28415 (M4I39_28385) 30557..30838 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M4I39_RS28420 (M4I39_28390) 30828..31079 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
M4I39_RS28425 (M4I39_28395) 32335..33171 + 837 WP_001050931.1 RepB family plasmid replication initiator protein -
M4I39_RS28430 (M4I39_28400) 33211..33657 + 447 WP_274486665.1 hypothetical protein -
M4I39_RS28435 (M4I39_28405) 33794..34147 + 354 WP_000876434.1 DNA distortion polypeptide 3 -
M4I39_RS28440 (M4I39_28410) 34207..35175 - 969 WP_274486666.1 IS5-like element IS903B family transposase -
M4I39_RS28445 (M4I39_28415) 35177..35470 - 294 WP_015060510.1 hypothetical protein -
M4I39_RS28450 (M4I39_28420) 35486..35716 - 231 WP_000051064.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(M) / floR / mcr-1.1 - 1..43761 43761


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T244899 WP_000220560.1 NZ_CP097194:c30838-30557 [Klebsiella pneumoniae]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT244899 WP_000121743.1 NZ_CP097194:c31079-30828 [Klebsiella pneumoniae]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References