Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 102168..102811 Replicon plasmid p652-2
Accession NZ_CP097192
Organism Klebsiella pneumoniae strain 15-652

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag M4I39_RS27470 Protein ID WP_000754566.1
Coordinates 102395..102811 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag M4I39_RS27465 Protein ID WP_001261276.1
Coordinates 102168..102398 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I39_RS27445 (M4I39_27410) 99095..99304 + 210 WP_094612253.1 hypothetical protein -
M4I39_RS27450 (M4I39_27415) 99338..100042 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
M4I39_RS27455 (M4I39_27420) 100363..100920 + 558 WP_001235713.1 recombinase family protein -
M4I39_RS27460 (M4I39_27425) 101103..101963 + 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
M4I39_RS27465 (M4I39_27430) 102168..102398 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M4I39_RS27470 (M4I39_27435) 102395..102811 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
M4I39_RS27475 (M4I39_27440) 102885..103853 + 969 WP_077260366.1 IS5 family transposase -
M4I39_RS27480 (M4I39_27445) 104171..105196 - 1026 WP_045340504.1 IS110 family transposase -
M4I39_RS27485 (M4I39_27450) 105458..106174 + 717 WP_004144002.1 phosphodiesterase MrkJ -
M4I39_RS27490 (M4I39_27455) 106209..106844 - 636 WP_000677445.1 type 3 fimbria minor subunit MrkF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA2 / qacE / sul1 / mph(A) / blaTEM-1B mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA 1..192753 192753
- inside IScluster/Tn aadA2 / qacE / sul1 / mph(A) / blaTEM-1B - 83854..105196 21342


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T244898 WP_000754566.1 NZ_CP097192:102395-102811 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT244898 WP_001261276.1 NZ_CP097192:102168-102398 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References