Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54500..55236 Replicon plasmid p652-2
Accession NZ_CP097192
Organism Klebsiella pneumoniae strain 15-652

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag M4I39_RS27215 Protein ID WP_003026803.1
Coordinates 54754..55236 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag M4I39_RS27210 Protein ID WP_003026799.1
Coordinates 54500..54766 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I39_RS27170 (M4I39_27135) 49729..50091 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M4I39_RS27175 (M4I39_27140) 50141..50491 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M4I39_RS27180 (M4I39_27145) 50849..51097 + 249 WP_001568018.1 hypothetical protein -
M4I39_RS27185 (M4I39_27150) 51094..51666 + 573 WP_001568017.1 hypothetical protein -
M4I39_RS27190 (M4I39_27155) 51697..52191 + 495 WP_001568016.1 hypothetical protein -
M4I39_RS27195 (M4I39_27160) 52424..52774 - 351 WP_167878626.1 hypothetical protein -
M4I39_RS27200 (M4I39_27165) 53226..53774 + 549 WP_001567366.1 thioredoxin fold domain-containing protein -
M4I39_RS27205 (M4I39_27170) 53821..54255 + 435 WP_001567367.1 cell envelope integrity protein TolA -
M4I39_RS27210 (M4I39_27175) 54500..54766 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
M4I39_RS27215 (M4I39_27180) 54754..55236 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
M4I39_RS27220 (M4I39_27185) 55437..56840 + 1404 WP_001567368.1 ISNCY-like element ISKpn21 family transposase -
M4I39_RS27225 (M4I39_27190) 56869..57501 - 633 WP_001567369.1 hypothetical protein -
M4I39_RS27230 (M4I39_27195) 57727..59073 + 1347 WP_077267029.1 ISNCY family transposase -
M4I39_RS27235 (M4I39_27200) 59122..59526 + 405 WP_064145647.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA2 / qacE / sul1 / mph(A) / blaTEM-1B mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA 1..192753 192753


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T244897 WP_003026803.1 NZ_CP097192:54754-55236 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT244897 WP_003026799.1 NZ_CP097192:54500-54766 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References