Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 36216..37126 Replicon plasmid p652-1
Accession NZ_CP097191
Organism Klebsiella pneumoniae strain 15-652

Toxin (Protein)


Gene name - Uniprot ID A0A5Q9LR54
Locus tag M4I39_RS25730 Protein ID WP_004181896.1
Coordinates 36656..37126 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A2J4RLY9
Locus tag M4I39_RS25725 Protein ID WP_004181895.1
Coordinates 36216..36659 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I39_RS25700 (M4I39_25670) 31371..31586 - 216 Protein_44 IS200/IS605 family transposase -
M4I39_RS25705 (M4I39_25675) 31588..32157 + 570 Protein_45 transposase -
M4I39_RS25710 (M4I39_25680) 32849..34336 + 1488 WP_004178082.1 group II intron reverse transcriptase/maturase -
M4I39_RS25715 (M4I39_25685) 34422..34844 + 423 WP_004181893.1 translesion error-prone DNA polymerase V autoproteolytic subunit -
M4I39_RS25720 (M4I39_25690) 34844..36115 + 1272 WP_004181894.1 translesion error-prone DNA polymerase V subunit UmuC -
M4I39_RS25725 (M4I39_25695) 36216..36659 + 444 WP_004181895.1 DUF2384 domain-containing protein Antitoxin
M4I39_RS25730 (M4I39_25700) 36656..37126 + 471 WP_004181896.1 RES family NAD+ phosphorylase Toxin
M4I39_RS25735 (M4I39_25705) 37236..37496 - 261 WP_004026352.1 hypothetical protein -
M4I39_RS25740 (M4I39_25710) 38067..39248 - 1182 WP_004883380.1 IS481 family transposase -
M4I39_RS25745 (M4I39_25715) 39320..39478 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
M4I39_RS25750 (M4I39_25720) 40081..41055 + 975 WP_040222313.1 hypothetical protein -
M4I39_RS25755 (M4I39_25725) 41253..41630 - 378 WP_004181901.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / aph(4)-Ia / aac(3)-IVa / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 - 1..275345 275345
- flank IS/Tn - - 31771..32157 386
- flank IS/Tn - - 38067..39248 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17549.81 Da        Isoelectric Point: 4.6155

>T244896 WP_004181896.1 NZ_CP097191:36656-37126 [Klebsiella pneumoniae]
VIFYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16536.87 Da        Isoelectric Point: 10.3013

>AT244896 WP_004181895.1 NZ_CP097191:36216-36659 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVVNRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LR54

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4RLY9

References