Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5187480..5188105 | Replicon | chromosome |
| Accession | NZ_CP097190 | ||
| Organism | Klebsiella pneumoniae strain 15-652 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A378FVD4 |
| Locus tag | M4I39_RS25115 | Protein ID | WP_019705794.1 |
| Coordinates | 5187480..5187863 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | M4I39_RS25120 | Protein ID | WP_004150355.1 |
| Coordinates | 5187863..5188105 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I39_RS25100 (5184846) | 5184846..5185748 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| M4I39_RS25105 (5185745) | 5185745..5186380 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M4I39_RS25110 (5186377) | 5186377..5187306 | + | 930 | WP_274486433.1 | formate dehydrogenase accessory protein FdhE | - |
| M4I39_RS25115 (5187480) | 5187480..5187863 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M4I39_RS25120 (5187863) | 5187863..5188105 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| M4I39_RS25125 (5188310) | 5188310..5189227 | + | 918 | WP_004146235.1 | alpha/beta hydrolase | - |
| M4I39_RS25130 (5189242) | 5189242..5190183 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| M4I39_RS25135 (5190228) | 5190228..5190665 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| M4I39_RS25140 (5190662) | 5190662..5191522 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| M4I39_RS25145 (5191516) | 5191516..5192115 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T244895 WP_019705794.1 NZ_CP097190:c5187863-5187480 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A378FVD4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |