Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4687583..4688099 | Replicon | chromosome |
| Accession | NZ_CP097190 | ||
| Organism | Klebsiella pneumoniae strain 15-652 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | M4I39_RS22745 | Protein ID | WP_004178374.1 |
| Coordinates | 4687583..4687867 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | M4I39_RS22750 | Protein ID | WP_002886901.1 |
| Coordinates | 4687857..4688099 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I39_RS22720 (4682978) | 4682978..4683241 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| M4I39_RS22725 (4683371) | 4683371..4683544 | + | 174 | WP_032412860.1 | hypothetical protein | - |
| M4I39_RS22730 (4683547) | 4683547..4684290 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| M4I39_RS22735 (4684647) | 4684647..4686785 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| M4I39_RS22740 (4687115) | 4687115..4687579 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| M4I39_RS22745 (4687583) | 4687583..4687867 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M4I39_RS22750 (4687857) | 4687857..4688099 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M4I39_RS22755 (4688177) | 4688177..4690087 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| M4I39_RS22760 (4690110) | 4690110..4691264 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| M4I39_RS22765 (4691331) | 4691331..4692071 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T244893 WP_004178374.1 NZ_CP097190:c4687867-4687583 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |