Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3976531..3977150 Replicon chromosome
Accession NZ_CP097190
Organism Klebsiella pneumoniae strain 15-652

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M4I39_RS19400 Protein ID WP_002892050.1
Coordinates 3976932..3977150 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M4I39_RS19395 Protein ID WP_002892066.1
Coordinates 3976531..3976905 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4I39_RS19385 (3971683) 3971683..3972876 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M4I39_RS19390 (3972899) 3972899..3976045 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M4I39_RS19395 (3976531) 3976531..3976905 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M4I39_RS19400 (3976932) 3976932..3977150 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M4I39_RS19405 (3977313) 3977313..3977879 + 567 WP_002892030.1 maltose O-acetyltransferase -
M4I39_RS19410 (3977851) 3977851..3977991 - 141 WP_004147370.1 hypothetical protein -
M4I39_RS19415 (3978012) 3978012..3978482 + 471 WP_002892026.1 YlaC family protein -
M4I39_RS19420 (3978457) 3978457..3979908 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
M4I39_RS19425 (3980009) 3980009..3980707 + 699 WP_002892021.1 GNAT family protein -
M4I39_RS19430 (3980704) 3980704..3980844 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M4I39_RS19435 (3980844) 3980844..3981107 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244891 WP_002892050.1 NZ_CP097190:3976932-3977150 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244891 WP_002892066.1 NZ_CP097190:3976531-3976905 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References