Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3976531..3977150 | Replicon | chromosome |
| Accession | NZ_CP097190 | ||
| Organism | Klebsiella pneumoniae strain 15-652 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M4I39_RS19400 | Protein ID | WP_002892050.1 |
| Coordinates | 3976932..3977150 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M4I39_RS19395 | Protein ID | WP_002892066.1 |
| Coordinates | 3976531..3976905 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4I39_RS19385 (3971683) | 3971683..3972876 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M4I39_RS19390 (3972899) | 3972899..3976045 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M4I39_RS19395 (3976531) | 3976531..3976905 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M4I39_RS19400 (3976932) | 3976932..3977150 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M4I39_RS19405 (3977313) | 3977313..3977879 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M4I39_RS19410 (3977851) | 3977851..3977991 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M4I39_RS19415 (3978012) | 3978012..3978482 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M4I39_RS19420 (3978457) | 3978457..3979908 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
| M4I39_RS19425 (3980009) | 3980009..3980707 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| M4I39_RS19430 (3980704) | 3980704..3980844 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M4I39_RS19435 (3980844) | 3980844..3981107 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244891 WP_002892050.1 NZ_CP097190:3976932-3977150 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244891 WP_002892066.1 NZ_CP097190:3976531-3976905 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |